PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr034525.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 721aa    MW: 78826.2 Da    PI: 5.321
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr034525.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS315.51.2e-963617192374
         GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                  +++L+++Ae +++g+  laq +Larl+++ sp g+p+ R a+yf+eAL+  l+  ++s++++al+p      + + ++ a+k fse+sP++ f+++t+
  Pbr034525.1 361 IDQLFNAAELIETGNSVLAQGILARLNHQLSPIGKPFSRTAFYFKEALQFLLNTnTSSNCSSALSP-----FSLIFKIGAYKSFSEISPVVHFANFTC 453
                  689*************************************************99333444444333.....3479*********************** PP

         GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrv 196
                  NqaIleaveg +rvH+iDfdi++G+QW++++q+ a R++g psl+iT++ s++++++ e++ t+e+L++fA+el++ fe +++   +le+l+  +L +
  Pbr034525.1 454 NQAILEAVEGFNRVHVIDFDIGYGGQWASFMQEVALRNGGVPSLKITAFISSSTHDEFEVSFTRENLEHFASELNLAFELELV---SLESLNSGSLGL 548
                  ***************************************************9*9****************************8...788888888755 PP

         GRAS 197 kp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgr 292
                       E +aV + l + ++ ++++sl+     +L++vk+lsP++vv  ++ +d+++ +F +++++al+ ys l++s++a    + ++ +k+Er ll++
  Pbr034525.1 549 PLhaSEGVAVAVNLPIGSFSNNPLSLPL----ILRFVKQLSPRIVVSLDRGSDRTDVPFPHQIIQALYSYSGLLESIDAA-NVNPDALQKIERYLLQP 641
                  4444888888888888999999999999....*********************************************665.34668999********* PP

         GRAS 293 eivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                   i+++v+  +       ++  +Wr  + ++GF+p+++s+++++qa++l++++++ g+++e+++ slvl+W+ + L+s+SaWr
  Pbr034525.1 642 GIEKIVTGCHLL----PKRTPSWRTLFLSSGFSPLTFSNFTESQAECLVQRTPVGGFHIEKRQSSLVLCWQCKDLISASAWR 719
                  ******988887....89999************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098544.803334699IPR005202Transcription factor GRAS
PfamPF035144.1E-94361719IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 721 aa     Download sequence    Send to blast
MWAALSPPLF SIPEEAQALR HPPQHCLPPT AAEPAVAAAX XXXXXXXXXX XXXXXXXXSG  60
AGGGCGRSTD TTTAGVENPS RTPLEEQKCG PPLGMEDWES VLSESPGQEQ SILRLIMSDI  120
EDPSLGLNTL LQSSSGSDHL HQDLEFSGGG FQDVVDQGGY GGGFEPNNNS GSLVSPSLHA  180
SSGPDFNFSN NASNVETRSS NVRPNHAIFS ASMSNPFLVS QSSGMFQQQQ SMGLDEKPQI  240
FNPQMVINQN QAQFAQHPAM FMPLTYAQLQ EHHLLSPPPS KRLNSGELGP SYPVQRVPFS  300
NPGQELVVRA QQQLQFLPQH LQQQRPTMPV AKEKMMSPAE GCKEMMNQNQ LQQQQFQQAV  360
IDQLFNAAEL IETGNSVLAQ GILARLNHQL SPIGKPFSRT AFYFKEALQF LLNTNTSSNC  420
SSALSPFSLI FKIGAYKSFS EISPVVHFAN FTCNQAILEA VEGFNRVHVI DFDIGYGGQW  480
ASFMQEVALR NGGVPSLKIT AFISSSTHDE FEVSFTRENL EHFASELNLA FELELVSLES  540
LNSGSLGLPL HASEGVAVAV NLPIGSFSNN PLSLPLILRF VKQLSPRIVV SLDRGSDRTD  600
VPFPHQIIQA LYSYSGLLES IDAANVNPDA LQKIERYLLQ PGIEKIVTGC HLLPKRTPSW  660
RTLFLSSGFS PLTFSNFTES QAECLVQRTP VGGFHIEKRQ SSLVLCWQCK DLISASAWRC  720
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-2737871921375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009342426.10.0PREDICTED: scarecrow-like protein 6
SwissprotO813161e-139SCL6_ARATH; Scarecrow-like protein 6
TrEMBLM5X7H70.0M5X7H7_PRUPE; Uncharacterized protein
STRINGVIT_15s0048g00270.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF31833170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.11e-129GRAS family protein